Integrative Physiology |
From the Center for Molecular Medicine, Maine Medical Center Research Institute, Scarborough.
Correspondence to Volkhard Lindner, MD, PhD, Center for Molecular Medicine Maine Medical Center Research Institute, 81 Research Dr, Scarborough, ME 04074. E-mail lindnv{at}mmc.org
| Abstract |
|---|
|
|
|---|
Key Words: calcification fibrosis remodeling adventitia intima
| Introduction |
|---|
|
|
|---|
During the arterial response to injury, adventitial fibroblasts transdifferentiate into myofibroblasts with characteristic expression of smooth muscle
-actin.2,5 As the healing process progresses, there is abundant deposition of extracellular matrix especially collagen type I, and at the same time, there is a decrease in cellularity and myofibroblasts disappear.6 TGF-ß has been implicated in myofibroblastic transdifferentiation5 and inhibition of TGF-ß signaling in this process did indeed block the adventitial myofibroblast differentiation process.
The present study originally emerged from a comparison of gene expression profiles of normal and 8 day balloon injured rat arteries using suppressive subtractive hybridization.7 During this screen, collagen triple helix repeat containing 1 (Cthrc1) was identified as a novel gene regulated by TGF-ß family members with expression restricted to the adventitia and neointima of injured arteries. In this study, we performed an initial biochemical and functional characterization of this novel molecule.
| Materials and Methods |
|---|
|
|
|---|
All surgical procedures were performed under general anesthesia by intraperitoneal injection of xylazine (2.2 mg/kg, AnaSed, Lloyd Laboratories) and ketamine (50 mg/kg body weight, Ketalar, Parke-Davis). The left carotid artery and the aorta were denuded with a 2F balloon catheter as described.8 Completely deendothelialized segments of arteries were identified by intravenous injection of Evans blue dye (0.5 mL of 5% solution in saline) five minutes before harvest of the vessels.9 Vessels used for immunoblot analysis were excised after perfusion of the animal with phosphate-buffered saline (PBS) and snap frozen in liquid nitrogen before protein extraction. For in situ hybridization, vessels were harvested after perfusion fixation with buffered 4% paraformaldehyde. For immunohistochemistry, the vessels were excised after perfusion fixation with Methyl Carnoys fixative.
Subtractive Hybridization and Cloning of the Cthrc1 cDNA
Suppressive subtractive hybridization7 was performed with a subtraction kit (PCR-Select cDNA Subtraction Kit, Clontech) following the manufacturers instructions. cDNA was prepared from 2 µg of mRNA RNA extracted from normal rat carotid arteries and aortae as well as corresponding 8-day balloon-injured vessels.8 For the purpose of isolating sequences overexpressed in injured arteries, cDNA from injured vessels was used as "tester" and cDNA from normal vessels as "driver" cDNA. The subtracted cDNAs were ligated into the pCRII cloning vector (Invitrogen). Partial sequences of approximately 300 clones were obtained by automated sequencing (ABI-PRISM 310 sequencer) and their identities were determined by searching Genbank databases including nonredundant and EST databases.
A cDNA library was prepared from RNA isolated from 8-day balloon-injured rat carotid arteries and aortae (Lambda ZAP Express, Stratagene). A 220-bp Cthrc1 cDNA clone obtained from the subtractive hybridization was used to prepare a 32P-labeled probe for screening of the library to obtain a full-length Cthrc1 cDNA clone. Clones hybridizing with the probe were isolated and sequenced with sequence-specific oligonucleotides (Integrated DNA Technologies).
The human Cthrc1 cDNA was cloned by 5'-RACE (Roche) using RNA prepared from cultured human SMCs. Three sequence-specific primers, based on the human expressed sequence tag (EST) clone (AA584310) were used to amplify the 5' region of Cthrc1 that was not present in Genbank at the time. The primer sequences were 5'-ATTTTAGCCGAAGTGAGC-3', 5'-CACTGAACAAAACTCTTA-3', and 5'-CTATTTGAACGCATCTTT-3'.
Cthrc1 Transcription and Translation
A full-length Cthrc1 cDNA was used to express protein with the TnT reticulocyte lysate system (Promega) in the presence of 35S-labeled methionine (New England Nuclear). The translated products were resolved by 12% SDS-PAGE followed by autoradiography of the gel.
Regulation of Cthrc1 Expression
The regulation of Cthrc1 mRNA and protein levels in response to various growth factors (10 ng/mL FGF-2, 1 ng/mL TGF-ß1, 10 ng/mL BMP-4, 10 ng/mL PDGF-AB; all from R&D Systems) and 10% bovine serum was examined in NIH3T3 cells and MC3T3-E1 cells. Before stimulation, the cells were placed in serum free medium for 24 hours and harvested for Northern and Western blotting at the indicated times after stimulation.
Antibody Generation and Western Blotting
Recombinant rat CTHRC1 protein lacking the signal sequence was tagged with 6 histidine residues (6xhis) fused to the C terminus and expressed in Escherichia coli. Purified CTHRC1 was used for immunization of rabbits. The anti-CTHRC1 antiserum recognized less than 1 ng of recombinant protein on immunoblots. Immunoblotting was performed with anti-CTHRC1 serum at a 1:3000 dilution. Equal amounts of protein were loaded in each lane based on spectrophotometric determination of protein concentration. A monoclonal antibody recognizing soluble procollagen (clone SP1.D8, Developmental Studies Hybridoma Bank) was used at a 1:1000 dilution.
Biochemical Characterization of Cthrc1
Recombinant myc-6xhistagged CTHRC1 with the signal sequence was expressed in CHO cells. The recombinant protein was purified from conditioned medium with Ni-NTA-Agarose (Qiagen). The purified protein was subjected to SDS-PAGE and transferred to a PVDF membrane (Bio-Rad), and the N terminal protein sequence was determined by automated Edman degradation to identify the cleavage site of the predicted signal peptide. To determine whether CTHRC1 is glycosylated, CTHRC1 purified from CHO cell conditioned medium was treated with and without N-glycosidase F (PNGase F, New England Biolabs) in sodium phosphate buffer (50 mmol/L, pH 7.5) supplemented with 1% NP-40 after reduction and denaturation. The enzymatic treatment was performed at 37°C for 120 minutes and was followed by immunoblotting of the samples with anti-CTHRC1 antibody or anti-his tag antibody. CHO cell expressed CTHRC1 was cross-linked with disuccinimidyl suberate (DSS, 1 mmol/L, pH8.9 for 30 minutes at 25°C), and both native and cross-linked CTHRC1 were examined by immunoblot analysis. The presence of a short collagen domain within CTHRC1 prompted us to examine whether CTHRC1 is a substrate for collagenase. 500 ng of purified his-tagged CTHRC1 were incubated with 200 U of highly purified collagenase (Sigma C0773, collagenase type VII) at 37°C for 120 minutes in buffer (0.15 mol/L NaCl, 50 mmol/L Tris pH7.6, 30 mmol/L CaCl2, 10 µmol/L ZnCl2). The digested CTHRC1 was examined by immunoblotting with an anti-his tag antibody and with three different polyclonal antibodies raised against recombinant CHTRC1.
Immunohistochemistry
Tissues were fixed in Methyl Carnoys fixative and embedded in paraffin. Sections were treated with 1% 2-mercaptoethanol for 30 minutes before incubation with anti-CTHRC1 antiserum (1:1000 dilution) overnight at 4°C. All other steps were performed as described.10 Either diaminobenzidine or 3-amino-9-ethylcarbazole (AEC) were used to visualize the immunoreactivity. Controls with preimmune serum (1:1000 dilution) from the same rabbit were included for all tissue sections, and at this dilution, nonspecific staining was negligible.
In Situ Hybridization
35S-UTPlabeled RNA probes corresponding to the sense and antisense strand of the coding region of rat Cthrc1 were prepared, and in situ hybridization was performed on paraffin sections as previously described.11
Cell Lines
Cthrc1 expression constructs were generated by cloning the coding region of the rat Cthrc1 cDNA into the expression vector pTriEx-1.1 Neo (Novagen), and a stably transfected PAC1 smooth muscle cell line12 was established using FuGene 6 transfection reagent (Roche). Because PAC1 cells express endogenous levels of Cthrc1, we also obtained stable PAC1 transfectants expressing Cthrc1 antisense RNA by cloning the coding region of Cthrc1 into pTriEx-1.1 Neo in reverse orientation. Empty vector transfected PAC1 transfectants were used as controls. Primary mouse embryonic fibroblast (MEF) cultures were established from 13-day-old wild-type and transgenic embryos expressing myc-tagged full-length CTHRC1 under CMV promoter control. Overexpression of CTHRC1 in the MEF from Cthrc1 transgenic embryos was verified by immunoblotting (data not shown) with an anti-myc antibody (clone 9E10, Zymed).
Northern Blotting
Northern blotting of total RNA (20 µg per lane) was performed as previously described.2 The major ribosomal RNA bands were visualized by ethidium bromide staining, and a full-length rat Cthrc1 cDNA was used to probe the membrane. RNA from PAC1 transfectants was examined for collagen type I expression using rat cDNAs for both the
1 and
2 chain and expression was normalized to GAPDH expression. Quantification of mRNA expression levels was performed with a phophorimager, and the values are shown relative to control cells (set at 100).
Cell Migration and Adhesion Assays
The migratory properties of confluent PAC1 cell transfectants and MEF from wild-type as well as Cthrc1 transgenic mice were examined in a scratch wound assays by creating a denuded zone with a pipette tip. These assays were performed on tissue culture treated plastic with and without prior coating with collagen type I (5 µg/cm2, BD-Biosciences). The area still devoid of cells was determined at the indicated time points by planimetry of digitized images used (NIH Image software). Three independent experiments with PAC1 transfectants and MEF derived from three different wild-type and Cthrc1 transgenic mice were performed and nearly identical results were obtained. ANOVA was used to determine whether significant differences between the means of groups were present (P
0.05). Multiple comparisons between groups were then performed using the Scheffé test.
| Results |
|---|
|
|
|---|
|
Using the 230-bp Cthrc1 cDNA as probe, a cDNA library prepared from 8-day balloon-injured rat arteries was screened to obtain a full-length cDNA clone. Several full-length clones were isolated and sequenced (GenBank accession nos. AY136824 and NM172333). The corresponding human cDNA homologue was cloned by 5'-RACE using RNA prepared from cultured human smooth muscle cells (SMCs) (GenBank accession no. AY136825). The sequences contained an open reading frame that predicted a 245 amino acid 26.5-kDa rat protein and a human homolog with 243 amino acids.
Database searches were performed to identify potential homologs of Cthrc1 in other species. With the Caenorhabditis elegans and Drosophila databases being more or less complete, it was very interesting to note that no homolog of Cthrc1 was detectable in these species. Sequences of sea squirt (Ciona intestinalis), fish (Fugu rubripes), chicken (Gallus gallus), and mammals were extremely highly conserved, especially the C-terminal 200 amino acids (Figure 2A).
|
Localization of Cthrc1 Within Injured Arteries and Vascular Calcifications
We used in situ hybridization and immunohistochemistry to examine Cthrc1 RNA and protein expression at the cellular level in balloon-injured arteries and human atherosclerotic plaque. Cthrc1 mRNA was expressed at high levels predominantly in the adventitia at 8 and 14 days after injury (Figure 3B and 3C). Lower levels of expression were also seen in the developing neointima (Figure 3C). At 4 weeks after injury when the response to injury was complete, only very little Cthrc1 expression was still detectable in the adventitia (Figure 3D). Immunohistochemistry localized CTHRC1 protein to the cellular compartment and extracellular matrix of the adventitia and neointima in remodeling arteries (Figure 3F), whereas no immunoreactivity was detectable in normal arteries (not shown). Examination of en face preparations demonstrated that Cthrc1 mRNA and protein is not detectable in endothelial cells (data not shown). In endarterectomy specimens obtained from human carotid artery lesions, immunoreactive CTHRC1 was associated with vascular calcifications (Figure 3G). No immunoreactive CTHRC1 was detectable in noncalcified plaque regions. Most intense immunoreactivity in these specimens was found at the outer margins of the calcification fronts. Cartilaginous matrix surrounding the calcified tissue also revealed CTHRC1 expression by chondrocyte-like cells (Figure 3G).
|
Regulation of Cthrc1 mRNA Expression
The expression of Cthrc1 in the adventitial fibroblasts led us to examine the effects of TGF-ß family members in NIH3T3 cells. Cthrc1 mRNA levels increased gradually in response to stimulation with BMP-4, with maximal levels seen at 24 hours after cytokine addition (Figure 4). Stimulation with TGF-ß1 also led to an increase in Cthrc1 mRNA levels with the highest levels observed 8 hours after growth factor addition (Figure 4). Platelet-derived growth factor (PDGF-AB) or fibroblast growth factor-2 (FGF-2) had no effect on Cthrc1 mRNA levels in NIH3T3 cells (data not shown).
|
Characterization of Recombinant Cthrc1
We performed in vitro translation with a rat Cthrc1 cDNA clone and the translated protein was resolved by 12% SDS-PAGE followed by autoradiography. A single specific band with an approximate molecular weight of 28 kDa (Figure 5A) was seen, and this band was absent from the reaction performed with the vector lacking a cDNA insert (Figure 5A).
|
A leucine-rich hydrophobic region is located at the amino terminus (amino acids 1 to 32 of rat CTHRC1, MHPQGRAASPQLLLGLFLVLLLLLQLSAPSSAS) that serves as a signal sequence. This was verified by N-terminal protein sequencing of purified rat CTHRC1 expressed in CHO cells (data not shown). A short G-X-Y repeat domain (12 triplets) characteristic of collagens is located between amino acids 59 and 93 (Figure 2B). The molecule is further characterized by the presence of 10 cysteine residues, which amounts to a cysteine content of 4.7% in the mature protein. The position of the cysteine residues was conserved among species. Glycosylation was examined by treatment of his-tagged CTHRC1 purified from CHO cell conditioned medium with N-glycosidase F. N-glycosidasetreated CTHRC1 migrated with an apparent molecular weight decreased by approximately 4 kDa compared with untreated CTHRC1 (Figure 5B).
Immunoblotting of CHO cellderived CTHRC1 with anti-CTHRC1 antibodies showed that under nonreducing conditions the recombinant CTHRC1 ran predominantly as a 50- and 75-kDa band (Figure 5C, lane 1, labeled NR). Under reducing conditions, however, the majority of the recombinant CTHRC1 migrated with an apparent molecular weight of 28 kDa as a single band (Figure 5C, lane 2, labeled R). Cross-linking of recombinant CTHRC1 with disuccinimidyl suberate (DSS) before reduction caused the majority of CTHRC1 to run with an apparent molecular weight of 84 kDa (Figure 5C, lane 3, labeled R+DSS).
The presence of a short collagen domain near the N-terminal portion of the mature protein is most likely responsible for the trimerization of the protein. This prompted us to examine whether CTHRC1 is susceptible to cleavage by collagenase. Recombinant CTHRC1 with a C-terminal his tag was incubated with highly purified collagenase and this generated a C-terminal fragment that was immunoreactive with the anti-his and anti-CTHRC1 antibodies (Figure 5D, apparent molecular weight approximately 20 kDa).
The localization of CTHRC1 to the extracellular matrix led us to investigate its effects on cell migration. PAC1 cells were stably transfected to generate CTHRC1 overexpressing cells and control vector transfectants. In addition, a stable antisense Cthrc1 transfected PAC cell line was established in which endogenous CTHRC1 levels were abolished (Figure 6A). It was interesting to note that the majority of endogenous CTHRC1 in PAC1 cells appeared to migrate in the form of two fragments with apparent molecular weights of 18 and 16 kDa (Figure 6A, arrowhead), whereas in CTHRC1-transfected PAC1 cells, full-length CTHRC1 (28 kDa) was the predominant form (Figure 6A, arrow). A scratch wound assay performed on confluent transfectants was used to determine the effect of CTHRC1 expression levels on cell migration. As shown in Figure 7A, migration and coverage of the scraped area was significantly increased in CTHRC1-overexpressing PAC1 cells compared with empty vector transfected PAC1 cells. This difference in migration was also observed when the same PAC1 transfectants were grown on collagen coated surfaces. The effect of increased CTHRC1 expression on cell migration was further verified using primary embryonic fibroblasts derived from wild-type and CTHRC1 transgenic mice and similar results were obtained (Figure 7B). These differences in cell migration were not attributable to differences in growth properties as growth curves established for the transfectants revealed no significant differences in cell growth (data not shown). Cell migration can be affected by large number of factors including alterations in extracellular matrix deposition. When we examined the PAC1 transfectants for levels of collagen type I, the predominant fibrillar collagen in these cells, it was found that mRNA levels for the
1 and
2 chain of collagen type I were reduced to 0.6% and 2%, respectively, to those observed in control PAC1 cells (Figure 6B). These dramatic differences in collagen type I mRNA levels were paralleled by equally dramatic differences in procollagen type 1 protein levels (Figure 6C). Procollagen type I levels were virtually undetectable both in the conditioned medium as well as cell lysates of CTHRC1-overexpressing PAC1 cells (Figure 6C).
|
|
| Discussion |
|---|
|
|
|---|
related proteins (CTRPs). CTRPs are signaling molecules that all share the presence of a short collagen domain followed by a globular C1q domain located at the C terminus. CTHRC1 has a similar collagen domain; however, the conserved amino acids that define the C1q domain are not present in CTHRC1. Within the collagenous domain of adiponectin is the lysine containing motif GXKGE(D), where sequential hydroxylation and glycosylation of lysine residues occurs.15 A similar motif is located within the collagen domain of CTHRC1 (GEKGEC, Figure 2B), and it is therefore likely that CHTRC1 undergoes a similar posttranslational modification; the deglycosylation experiments performed here (Figure 5B) are in agreement with this explanation. Cleavage experiments with collagenase support the notion that the collagen domain within CTHRC1 is responsible for triple helix formation and this is consistent with cross-linking studies of CTHRC1 (Figure 5C). As shown in Figure 5C, approximately only half of the CTHRC1 underwent cleavage by collagenase and this could potentially be explained by the fact that a similar portion of CTHRC1 in the sample is present as an apparent trimer, whereas the remainder represents a dimeric form (Figure 5C, lane 1) that would not be susceptible to cleavage by collagenase. The transient expression of CTHRC1 in the vessel on injury and its presence in calcified atherosclerotic plaque indicate some similarities with other matrix proteins such as osteopontin. CTHRC1 resides in calcified atherosclerotic plaque particularly at the calcifying front which is the same location where osteopontin is found.16 It was interesting to note that the chondrocyte-like cells surrounding the calcification also expressed CTHRC1 (Figure 3G). As was mentioned above, the adventitia is the major site of TGF-ß signaling activity after vascular injury.2 As Cthrc1 expression is inducible by TGF-ß family members in fibroblasts, it was not surprising to see Cthrc1 expression induced mainly in the adventitial fibroblasts on injury.
Overexpression of CTHRC1 in PAC1 and MEF cells led to a significant increase in their migratory ability. Understanding the mechanism by which CTHRC1 increases cell migration requires further investigation. It is a possibility that the suppression of collagen type I matrix production by CTHRC1 is involved in this process, although migration on collagen-coated surfaces was increased in both control and CTHRC1 overexpressing cells. The nearly complete suppression of all collagen type I
chain transcripts is potentially of major therapeutic importance as this may provide an avenue to interfere with fibrotic processes that ultimately lead to organ failure and with regards to angioplasty to constrictive remodeling. The mechanism by which CTHRC1 inhibits collagen type 1 mRNA expression is presently not known and it raises the possibility that CTHRC1, similar to CTRPs, functions as a signaling molecule. Of interest was also the fact that the majority of endogenous CTHRC1 in PAC1 cells was present as a cleaved molecule. This observation indicates the CTHRC1 may undergo proteolytic processing and this in turn could have implications for the activity of the molecule.
In summary, this is the first report describing the novel gene Cthrc1, a highly conserved sequence among chordates. Our data indicate that this glycosylated protein is expressed at sites of tissue injury where it might participate in the regulation of collagen matrix deposition and cell migration. As a potent negative regulator of collagen matrix deposition, CTHRC1 may have therapeutic value in antifibrotic treatment strategies.
| Acknowledgments |
|---|
| Footnotes |
|---|
| References |
|---|
|
|
|---|
2. Smith JD, Bryant SR, Couper LL, Vary CP, Gotwals PJ, Koteliansky VE, Lindner V. Soluble transforming growth factor-beta type II receptor inhibits negative remodeling, fibroblast transdifferentiation, and intimal lesion formation but not endothelial growth. Circ Res. 1999; 84: 12121222.
3. Ryan ST, Koteliansky VE, Gotwals PJ, Lindner V. Transforming growth factor-beta-dependent events in vascular remodeling following arterial injury. J Vasc Res. 2003; 40: 3746.[CrossRef][Medline] [Order article via Infotrieve]
4. Bryant SR, Bjercke RJ, Erichsen DA, Rege A, Lindner V. Vascular remodeling in response to altered blood flow is mediated by fibroblast growth factor-2. Circ Res. 1999; 84: 323328.
5. Desmouliere A, Geinoz A, Gabbiani F, Gabbiani G. Transforming growth factor-beta 1 induces alpha-smooth muscle actin expression in granulation tissue myofibroblasts and in quiescent and growing cultured fibroblasts. J Cell Biol. 1993; 122: 103111.
6. Desmouliere A, Badid C, Bochaton-Piallat ML, Gabbiani G. Apoptosis during wound healing, fibrocontractive diseases and vascular wall injury. Int J Biochem Cell Biol. 1997; 29: 1930.[CrossRef][Medline] [Order article via Infotrieve]
7. Diatchenko L, Lau YF, Campbell AP, Chenchik A, Moqadam F, Huang B, Lukyanov S, Lukyanov K, Gurskaya N, Sverdlov ED, Siebert PD. Suppression subtractive hybridization: a method for generating differentially regulated or tissue-specific cDNA probes and libraries. Proc Natl Acad Sci U S A. 1996; 93: 60256030.
8. Clowes AW, Reidy MA, Clowes MM. Kinetics of cellular proliferation after arterial injury, I: smooth muscle growth in the absence of endothelium. Lab Invest. 1983; 49: 327333.[Medline] [Order article via Infotrieve]
9. Lindner V, Fingerle J, Reidy MA. Mouse model of arterial injury. Circ Res. 1993; 73: 792796.
10. Lindner V. Role of basic fibroblast growth factor and platelet-derived growth factor (B-chain) in neointima formation after arterial injury. Z Kardiol. 1995; 84 (suppl 4): 137144.[Medline] [Order article via Infotrieve]
11. Landry DB, Couper LL, Bryant SR, Lindner V. Activation of the NF-
B and I
B system in smooth muscle cells after rat arterial injury. Induction of vascular cell adhesion molecule-1 and monocyte chemoattractant protein-1. Am J Pathol. 1997; 151: 10851095.[Abstract]
12. Firulli AB, Han D, Kelly-Roloff L, Koteliansky VE, Schwartz SM, Olson EN, Miano JM. A comparative molecular analysis of four rat smooth muscle cell lines. In Vitro Cell Dev Biol Anim. 1998; 34: 217226.[Medline] [Order article via Infotrieve]
13. Doliana R, Mongiat M, Bucciotti F, Giacomello E, Deutzmann R, Volpin D, Bressan GM, Colombatti A. EMILIN, a component of the elastic fiber and a new member of the C1q/tumor necrosis factor superfamily of proteins. J Biol Chem. 1999; 274: 1677316781.
14. Wong GW, Wang J, Hug C, Tsao TS, Lodish HF. A family of Acrp30/adiponectin structural and functional paralogs. Proc Natl Acad Sci U S A. 2004; 101: 1030210307.
15. Wang Y, Xu A, Knight C, Xu LY, Cooper GJ. Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin: potential role in the modulation of its insulin-sensitizing activity. J Biol Chem. 2002; 277: 1952119529.
16. Fitzpatrick LA, Severson A, Edwards WD, Ingram RT. Diffuse calcification in human coronary arteries: association of osteopontin with atherosclerosis. J Clin Invest. 1994; 94: 15971604.[Medline] [Order article via Infotrieve]
This article has been cited by other articles:
![]() |
Y. Wang Wnt/Planar cell polarity signaling: A new paradigm for cancer therapy Mol. Cancer Ther., August 1, 2009; 8(8): 2103 - 2109. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. J. LeClair, Q. Wang, M. A. Benson, I. Prudovsky, and V. Lindner Intracellular Localization of Cthrc1 Characterizes Differentiated Smooth Muscle Arterioscler Thromb Vasc Biol, July 1, 2008; 28(7): 1332 - 1338. [Abstract] [Full Text] [PDF] |
||||
![]() |
B.-Y. Kang, S. Tsoi, Shan Zhu, Shenghui Su, and H. H. Kay Differential Gene Expression Profiling in HELLP Syndrome Placentas Reproductive Sciences, March 1, 2008; 15(3): 285 - 294. [Abstract] [PDF] |
||||
![]() |
K. Maiellaro and W. R. Taylor The role of the adventitia in vascular inflammation Cardiovasc Res, September 1, 2007; 75(4): 640 - 648. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Gavazzi, C. Deffert, C. Trocme, M. Schappi, F. R. Herrmann, and K.-H. Krause NOX1 Deficiency Protects From Aortic Dissection in Response to Angiotensin II Hypertension, July 1, 2007; 50(1): 189 - 196. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. J. LeClair, T. Durmus, Q. Wang, P. Pyagay, A. Terzic, and V. Lindner Cthrc1 Is a Novel Inhibitor of Transforming Growth Factor-{beta} Signaling and Neointimal Lesion Formation Circ. Res., March 30, 2007; 100(6): 826 - 833. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. Tang, D. L. Dai, M. Su, M. Martinka, G. Li, and Y. Zhou Aberrant Expression of Collagen Triple Helix Repeat Containing 1 in Human Solid Cancers. Clin. Cancer Res., June 15, 2006; 12(12): 3716 - 3722. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Circulation Research Home | Subscriptions | Archives | Feedback | Authors | Help | AHA Journals Home | Search Copyright © 2005 American Heart Association, Inc. All rights reserved. Unauthorized use prohibited. |