Articles |
the Vascular Medicine and Atherosclerosis Unit (R.K., P.L.), Cardiovascular Division, Department of Medicine, Brigham and Women's Hospital, and the Dana-Farber Cancer Institute (S.K.C.), Boston, Mass; the Cardiovascular Research Institute (K.I., S.R.C.), University of California, San Francisco; and the Wadsworth Center for Laboratories and Research (J.W.F. II), New York State Department of Health, Albany.
Correspondence to Peter Libby, MD, Vascular Medicine and Atherosclerosis Unit, Brigham and Women's Hospital, 221 Longwood Ave, LMRC 307, Boston, MA 02115.
| Abstract |
|---|
|
|
|---|
-thrombin (EC50,
500 pmol/L) potently induced interleukin (IL)-6 release from SMCs. The tethered-ligand thrombin receptor appeared to mediate this effect. Furthermore,
-thrombin also rapidly increased levels of mRNA encoding IL-6 and monocyte chemotactic protein-1 (MCP-1) in SMCs. In contrast, only
-thrombin concentrations of
100 nmol/L could stimulate release of IL-6 or tumor necrosis factor-
(TNF
) in peripheral blood monocytes or monocyte-derived macrophages. Lipid loading of macrophages did not augment thrombin responsiveness. Likewise, only
-thrombin concentrations of
100 nmol/L increased levels of IL-6, IL-1ß, MCP-1, or TNF
mRNA in monocytes. Differential responses of SMCs and monocytes to thrombin extended to early agonist-mediated increases in [Ca2+]i. SMCs and endothelial cells, but not monocytes, contained abundant mRNA encoding the thrombin receptor and displayed cell surface thrombin receptor expression detected with a novel monoclonal antibody. Thus, the level of thrombin receptors appeared to account for the differential thrombin susceptibility of SMCs and monocytes. These data suggest that SMCs may be more sensitive than monocytes/macrophages to thrombin activation in human atheroma. Cytokines produced by thrombin-activated SMCs may contribute to ongoing inflammation in atheroma complicated by thrombosis or subjected to angioplasty.
Key Words: atherosclerosis thrombosis inflammation restenosis monocyte chemotactic protein-1
| Introduction |
|---|
|
|
|---|
30-day) inflammatory response in rabbits.9 Accumulating evidence suggests a role for chronic or cyclic inflammation in the pathogenesis of coronary artery disease and atherosclerosis in general.10 11 The recent molecular characterization of a thrombin receptor using a novel "tethered-ligand" extracellular signaling mechanism has renewed interest in thrombin effects on atheroma-associated cells. Good evidence supports thrombin as an activator of platelets, ECs, and SMCs. Our laboratory has had a particular interest in mononuclear phagocytes in atherogenesis. Specifically, we have hypothesized roles for macrophages as amplifiers of inflammatory and fibrogenic stimuli after balloon injury.12 However, scant data exist regarding the effects of thrombin on mononuclear phagocytes. Therefore, we investigated possible links between thrombosis and vascular inflammation by examining the ability of thrombin to induce cytokine production in vascular SMCs and monocytes/macrophages, two major cellular constituents of the atherosclerotic plaque.13
| Materials and Methods |
|---|
|
|
|---|
-thrombin was prepared and characterized as described earlier with specific activities of 3168 U/mg protein (1 nmol/L=1.2 U/mL; lot 1) and 2687 U/mg protein (1 nmol/L=1.0 U/mL; lot 2).14 PPACK
-thrombin was prepared from
-thrombin.15 Thrombin receptor activator peptides with the sequences SFLLRNPNDKYEPF and SFLLRNR16 17 were purchased from Bachem. Leech-derived hirudin was obtained from Sigma Chemical Co. Testing for bacterial endotoxin with the Limulus amebocyte lysate assay (BioWhittaker) revealed levels of
70 pg/mL for all agents. LPS derived from Escherichia coli (055:B5) was from Sigma. Recombinant human MCSF was a gift of Genetics Institute, Inc. Acetylated LDL was purchased from Biomedical Technologies. Fura 2-AM, digitonin, and FMLP were purchased from Sigma.
Cell Preparation and Culture
Vascular SMCs were cultured by explant outgrowth from unused portions of human saphenous veins harvested for coronary bypass surgery under a protocol approved by the institutional Human Investigation Review Committee. Cells were grown in DMEM (BioWhittaker) supplemented with 10% (vol/vol) FCS (Hyclone), 100 U/mL penicillin, 100 µg/mL streptomycin, 1.25 µg/mL amphotericin B, 2 mmol/L L-glutamine, and 25 mmol/L HEPES. The cells exhibited the typical "hill-and-valley" growth morphology of SMCs, and many contained muscle forms of actin. Cells from passages 2 to 5 were used for the experiments after being growth-arrested for 2 days in serum-free IT medium18 consisting of DMEM/F-12 Ham (BioWhittaker, 1:1 [vol/vol]) supplemented with 1 µmol/L insulin and 5 µg/mL transferrin. Fresh IT medium was used for the experiments with or without addition of stimuli.
Human peripheral blood monocytes were isolated from buffy coats freshly prepared from healthy volunteer platelet donors at the blood bank of the Dana-Farber Cancer Institute. After centrifugation against Ficoll-Hypaque (Histopaque-1077, Sigma) at 2000g for 20 minutes, the cells in the mononuclear layer were resuspended in RPMI-1640 (BioWhittaker) with 10% FCS, L-glutamine, HEPES, and antibiotics. After adherence on plastic tissue culture flasks for 2 to 4 hours, nonadherent cells were removed, and the remaining cells were washed three times with PBS (pH 7.4) and replenished with medium. On the following day, the cells were gently detached with a cell scraper and, after centrifugation for 5 minutes at 200g, resuspended in RPMI-1640 with 1 mg/mL HSA (New York Blood Center), counted in a hemocytometer, and used for experiments. Alternatively, for experiments with RNA isolation, monocytes were obtained by Ficoll-Hypaque centrifugation followed by counterflow centrifugation/elutriation (courtesy of Dr F.W. Luscinskas, Brigham and Women's Hospital) with a purity of typically
80%, as determined by light scatter and cell surface antigen analysis for CD14.19
Monocyte-derived macrophages were prepared in vitro by maintaining freshly isolated peripheral blood monocytes for 14 days in RPMI-1640 with 10% FCS and 1000 U/mL MCSF in 24-well plates at an initial density of 1x106 cells/mL. The medium was changed every 3 days. At the end of the 14-day period, the cells were firmly attached to the surface and had a typical stellate shape. Foam cells were generated by the addition of 50 µg/mL acetylated LDL for the last 3 days of the 2-week period. For the stimulation experiments, the medium was changed to RPMI-1640 with 1 mg/mL HSA.
Human ECs were harvested by enzymatic dissociation from saphenous veins with 1 mg/mL type II collagenase, as described previously.20 The cells were cultured on plastic dishes covered with low pyrogen fibronectin (1.5 µg/cm2, New York Blood Center) in medium 199 (BioWhittaker) with 5% FCS, 10 mg/mL heparin, 50 µg/mL endothelial cell growth factor (extracted from bovine hypothalamus), L-glutamine, HEPES, and antibiotics.
Determination of IL-6 and TNF
Release
SMCs were grown to confluence in 96-well plates and kept in IT medium for 2 days before the experiment. Monocytes were plated at a density of 2x106 cells/mL in 96-well plates. Monocyte-derived macrophages and foam cells were used in the initial 24-well plates. After addition of the stimuli, cells were incubated for 24 hours, and then the conditioned medium was collected and frozen. Assays for IL-6 and TNF
were performed with ELISA kits (Endogen) according to the manufacturer's instructions. The assays selectively recognize IL-6 and TNF
, with limits of detection of 4 pg/mL and 5 pg/mL, respectively.
RNA Isolation and Northern Analysis
Confluent SMCs in 150-cm2 tissue culture flasks and 30 to 40x106 of monocytes per flask were used for total RNA extraction by lysis in 4 mol/L guanidinium isothiocyanate/3% ß-mercaptoethanol/10 mmol/L Tris-HCl at pH 7.4 and by centrifugation through a cesium chloride density gradient.21 After verification of integrity and quantity, RNA was electrophoresed through 1% agarose gels in the presence of 0.5% formaldehyde, transferred to nylon membranes (Hybond N, Amersham), and cross-linked by UV irradiation. Blots were prehybridized for at least 3 hours at 42°C in 50% formamide, 150 mmol/L Tris (pH 7.5), 0.75 mol/L NaCl, 50 mmol/L NaH2PO4, 100 mmol/L Na2HPO4, 2 mmol/L Na2H2P2O7, 10x Denhardt's solution, 10 mmol/L EDTA, 1 mg/mL SDS, and 200 µg/mL sheared salmon sperm DNA. Hybridization was performed overnight at 42°C in a fresh solution of the above composition with the addition of 10 mg/mL dextran sulfate and DNA probes labeled with [32P]dCTP (New England Nuclear) using a kit for random hexanucleotide-primed synthesis (Pharmacia). The blots were washed with increasingly stringent conditions up to 0.1x SSC (1x SSC contains 150 mmol/L NaCl and 15 mmol/L sodium citrate at pH 8) at 65°C in the presence of 0.1% SDS. Autoradiography was performed using DuPont NEF-496 film (DuPont) with an intensifying screen at -70°C. The cDNA probes used were a 900-b EcoRI-HindIII fragment of human IL-6 cDNA,22 a 754-b Xho I fragment of the human JE-34 (MCP-1) cDNA,23 a 1.1-kb Sac IPst I fragment of human IL-1ß,24 an 800-b EcoRI fragment of human TNF
,25 and a 789-b Pst IMst II fragment of the human thrombin receptor cDNA.16
Measurement of [Ca2+]i
[Ca2+]i was determined according to Grynkiewicz et al.26 Peripheral blood monocytes or SMCs in suspension were incubated with the fluorescent probe fura 2-AM in a balanced solution (mmol/L: NaCl 129, NaHCO3 8.9, KCl 2.8, KH2PO4 0.8, glucose 5.6, HEPES 10, and MgCl2 0.8 at pH 7.4)27 at 37°C for 15 minutes. After 2 washes, the cells were resuspended in the buffer in the presence of 1 mmol/L CaCl2. Fluorescence of fura 2loaded cells stirred at 37°C was continuously monitored in a Fluorolog-2 spectrofluorimeter (model CM-1) with alternating excitation wavelengths set at 340 and 380 nm and emission recorded at 505 nm. For internal calibration at the end of each experiment, 20 µmol/L digitonin was added for equilibration of intracellular and extracellular Ca2+ and subsequent quenching of Ca2+ by 22 mmol/L EGTA. [Ca2+]i was calculated with the following formula26 :
![]() |
Production and Characterization of Monoclonal Antibody Against Thrombin Receptor
Monoclonal Antibody Production
Balb/c mice were immunized with the 41amino acid peptide PESKATNATLDPRPFLLRNPNDKYEPFWEDEEKNESGLTEC conjugated to keyhole limpet hemocyanin via the added carboxy-terminal cysteine. This peptide corresponds to amino-terminal exodomain residues 29 to 69 of human thrombin receptor, except that the native serine 42 (the P1' residue at the thrombin cleavage site) was changed to proline to minimize proteolytic cleavage in vivo. Hybridomas were generated,28 and supernatants were screened by quantifying surface binding to naive Rat 1 cells versus Rat 1 cells stably transfected with the human thrombin receptor. Antibody binding studies to mammalian cells and oocytes were performed using hybridoma supernatant at a 1:100 dilution exactly as previously described.29 30 The monoclonal antibody that gave the greatest specific binding was designated PF11 and was used in this study. PF11 belongs to the IgG2b
light chain class.
Characterization of the Monoclonal Antibody PF11
Rat 1 cells stably transfected with human thrombin receptor cDNA bound over 20-fold more PF11 than did untransfected parent cells. PF11 also bound to the Xenopus laevis oocytes expressing wild-type human thrombin receptor but did not bind to control oocytes (data not shown). As expected, the epitope for PF11 was within the receptor's amino-terminal exodomain, because a chimeric protein, ATE-CD8, in which the receptor's amino-terminal exodomain was joined to the transmembrane region of CD831 supported PF11 binding when expressed in Cos 7 cells. This binding did not change with cleavage of ATE-CD8 by thrombin, suggesting that the epitope recognized by PF11 is carboxyl to the thrombin cleavage site between R41 and S42.
The specificity of PF11 was further tested, and its recognition site was further characterized by examining antibody binding to Cos 7 cells transiently transfected with wild-type or mutant human thrombin receptor cDNAs made for other purposes. These studies revealed that the sequence including receptor residues 47 to 60 was both necessary and sufficient for recognition by PF11 (Table
). This region includes the receptor's hirudin-like domain DKYEPF that in part mediates thrombin binding32 33 34 and has proven antigenic in previous studies.35 Furthermore, the protein recognized by PF11 migrated as a broad band at
66 kD on immunoblot, corresponding in size to the protein recognized by other thrombin receptor antibodies in receptor-transfected but not in untransfected cells.35 36
|
FACS Analysis
For FACS analysis, ECs and SMCs were detached from the culture dish by incubation with 200 µg/mL EDTA in PBS (BioWhittaker) at 37°C. These cells and freshly isolated monocytes were washed twice with PBS and incubated on ice for 30 minutes with the primary antibody diluted 1:100 in PBS with 2% (vol/vol) horse serum. Monoclonal antibody PF11 was used to assess expression of thrombin receptors on the cell surface. A murine monoclonal antibody against class I major histocompatibility complex37 was used as a positive control, and purified IgG1
from mouse myeloma protein (MOPC 21, Sigma) served as negative control. After two washes, the secondary antibody (fluorescein isothiocyanateconjugated anti-mouse IgG antibody produced in donkey, Jackson Immunoresearch) was added in a dilution of 1:100 for 30 minutes. After two more washes, cells were fixed in 1% formaldehyde in PBS and analyzed on a FACS scan flow cytometer (Becton Dickinson).
| Results |
|---|
|
|
|---|
-Thrombin caused concentration-dependent IL-6 release from SMCs from 100 pmol/L, the lowest concentration tested, and reached a plateau at 10 nmol/L (Fig 1
release (data not shown), consistent with earlier findings that in SMCs this process requires "superinduction" conditions in vitro.39
|
Monocytes Secrete Cytokines in Response to High Thrombin Concentrations
Freshly isolated monocytes responded to
-thrombin with cytokine secretion only at concentrations of
100 nmol/L (Fig 2
). In contrast, these cells elaborated large amounts of both TNF
and IL-6 when challenged with LPS (see Fig 2
legend), demonstrating an intact secretory capacity upon appropriate stimulation. Independent experiments with monocyte isolates from four additional donors gave comparable results, indicating that the low responsiveness of monocytes to thrombin does not result from interindividual variability (data not shown). PPACK-thrombin at 1 µmol/L, the highest tested concentration for
-thrombin, yielded very slight, but detectable, cytokine release compared with the enzymatically active compound. This finding has several possible explanations: First, there might be some residual catalytic activity in the PPACK-thrombin preparation. Also, at the high protein concentration used, trace contaminants could induce cytokine production independent of thrombin activity. However, we cannot exclude thrombin-signaling pathways independent of the tethered-ligand receptor, since others have reported that peripheral blood monocytes show enhanced chemotaxis to thrombin in the low nanomolar range independent of its catalytic activity.40
|
The Low Responsiveness of Monocytes to Thrombin Does Not Depend on Their State of Differentiation
Monocytes undergo a variety of phenotypic changes during differentiation to macrophages, the monocytic cell type resident in tissues such as atheroma. Therefore, we considered that blood monocytes might also alter their responsiveness to thrombin during the process of differentiation to macrophages, so we stimulated freshly isolated monocytes for 14 days with MCSF, a macrophage survival and differentiation factor,41 which is found in human and experimental atheromatous lesions.42 However, even these monocyte-derived macrophages required very high (µmol/L) concentrations of thrombin to stimulate only a fraction of the IL-6 or TNF
release induced by LPS (Fig 3
). We also incubated monocyte-derived macrophages with acetylated LDL, which results in foam cell formation after 3 days, as judged by the presence of numerous intracellular lipid droplets seen by phase-contrast microscopy and oil red O staining (not shown). These foam cells also released cytokines only in response to relatively high concentrations of thrombin (Fig 3
). In contrast to monocytes, which secreted relatively more TNF
than IL-6 upon thrombin stimulation, macrophages and foam cells had a greater secretion of IL-6 relative to TNF
. This finding reflects the phenotypic shift that occurs during differentiation of mononuclear phagocytes.
|
Thrombin Induces Cytokine mRNAs in SMCs but Not in Monocytes
In SMCs, 10 nmol/L
-thrombin caused rapid accumulation of IL-6 mRNA (Fig 4
), suggesting that the observed IL-6 release results from enhanced translation and de novo protein synthesis. Previous experiments had shown no effect of the serum-free medium used on IL-6 mRNA expression for up to 24 hours.38 Thrombin also induced mRNA encoding the chemokine MCP-1, in accord with recent observations of Wenzel et al43 and Grandaliano et al.44 TNF
mRNA showed no consistent increase with thrombin stimulation (data not shown), again consistent with our prior results indicating a requirement for superinduction of TNF
mRNA in cultured SMCs.39 Northern blots with RNA from thrombin-stimulated monocytes probed for a variety of cytokine genes (IL-6, IL-1ß, MCP-1, and TNF
) showed clear increases in mRNA levels only at 1 µmol/L
-thrombin (Fig 5
), consistent with our results regarding cytokine protein secretion.
|
|
Evidence That the Tethered-Ligand Receptor Mediates Thrombin-Induced Cytokine Secretion by SMCs
To characterize further the effect of thrombin on IL-6 secretion from SMCs, we conducted parallel experiments with
-thrombin in the presence and absence of hirudin and with catalytically inactive PPACK-thrombin (Fig 6
, top). Hirudin prevented
-thrombininduced IL-6 release over the complete concentration range, demonstrating the specificity of the thrombin effect. Boiled thrombin lacked stimulatory activity (not shown). Thrombin treated with its inhibitor PPACK produced only modest IL-6 release at high concentrations (10 nmol/L). The thrombin receptor agonist peptides SFLLRNR and SFLLRNPNDKYEPF caused IL-6 secretion over the same concentration range (1 to 200 µmol/L) reported to stimulate DNA synthesis in rat SMCs.45 The peptides increased IL-6 release to an extent similar to that of the maximally active concentration of
-thrombin (Fig 6
, bottom). These findings suggest involvement of the tethered-ligand thrombin receptor as the mediator of thrombin-induced IL-6 production. In peripheral blood monocytes, the peptide SFLLRNR at 100 µmol/L slightly increased IL-6 release (control, 0±0 pg/mL; SFLLRN at 100 µmol/L, 5.0±0.8 pg/mL; n=3 or 4, P<.05). This result indicates only a very low level of thrombin receptorsignaled activation of the mononuclear phagocytes and suggests that some of the residual effects of very high concentrations of thrombin on this cell type may result from nonspecific proteolytic effects or a pathway different from thrombin receptor activation.
|
Monocytes and SMCs Also Differ in Early Thrombin-Induced Signaling Events
We wished to determine whether the differences in thrombin responsiveness of monocytes/macrophages and SMCs extended beyond cytokine production. Further experiments compared thrombin-induced increases in intracellular Ca2+, an early agonist-mediated change that has been described for
-thrombin activation of several cell types.16 46 Thrombin raised [Ca2+]i in SMCs at 10 and 100 nmol/L but failed to increase [Ca2+]i in monocytes at concentrations up to 1 µmol/L (Fig 7
).
|
SMCs and Monocytes Differ Markedly in Thrombin Receptor Expression
The foregoing data suggested that the lower responsiveness of monocytes/macrophages to thrombin compared with SMCs results from difference(s) in early signal transduction. Therefore, we investigated the possibility that these two cell types differ in the expression of the cloned thrombin receptor thought to mediate most47 effects of thrombin on cells. Northern blotting for the thrombin receptor mRNA revealed no detectable signal in monocytes but abundant expression in ECs and SMCs (Fig 8
, top). Monocytes from multiple donors consistently exhibited little or no detectable mRNA for the thrombin receptor. This result agrees with the finding of low-level thrombin receptor mRNA expression in human peripheral blood monocytes detected by in situ hybridization.48 However, mRNA levels may not necessarily reflect actual receptor protein expression. Further experiments studied cell surface expression of the thrombin receptor by FACS analysis of monocytes, SMCs, and ECs as a positive control (Fig 8
, bottom). Compared with controls with irrelevant antibody, ECs displayed surface expression of the thrombin receptor (Fig 8
, bottom, histograms on left). SMCs showed lower levels than did ECs but clearly expressed thrombin receptors as well (Fig 8
, bottom, middle histograms). In contrast, monocytes showed no thrombin receptor surface expression (Fig 8
, bottom, histograms on right). The response of monocytes at high thrombin concentrations with cytokine release may reflect expression of a small number of receptors undetectable by this technique. Alternatively, nonthrombin receptordependent pathways or trace contaminants in the thrombin preparations used may mediate these effects.
|
| Discussion |
|---|
|
|
|---|
Many examples of thrombin actions on cells in addition to its central role in the coagulation cascade exist.56 Several studies have focused on the ability of thrombin to induce proliferation of vascular SMCs.45 57 58 However, recent data show low proliferative rates of SMCs in advanced human atheroma59 and conflicting results for cell proliferation in restenotic tissue.60 61 Although such findings suggest consideration of the nonmitogenic effects of thrombin, this protease has received little attention as a stimulus of inflammatory signals during atherogenesis.
Monocytes/macrophages and foam cells figure prominently in initiation and progression of the atherosclerotic plaque62 and possibly in restenosis.12 Among many monocyte functions, secretion of proinflammatory cytokines probably influences lesion formation.63 64 The association of thrombotic coronary events with local inflammation and the propensity of plaques to rupture at sites of macrophage concentration and inflammatory activation3 suggested to us that thrombin might activate monocytes/macrophages to secrete cytokines. However, the present data showed that freshly isolated peripheral monocytes responded by cytokine production only at high concentrations of
-thrombin despite intact secretory capability, as evidenced by their response to bacterial endotoxin.
These observations contrast with reports that thrombin increases LPS-stimulated IL-1 production in guinea pig macrophages65 and MCP-1 production in human peripheral blood mononuclear cells and monocytes.66 The differences between these results and ours might result from preactivation of cells in the two former studies. The failure of high thrombin concentrations to induce Ca2+ transients in monocytes in our study also contrasts with a recent study67 that describes increases in [Ca2+]i upon stimulation of human monocytes with
-thrombin or thrombin receptor agonist peptide. The interpretation of these results is complex, since the authors describe contamination of their monocyte preparation with platelets. Another study using the human monocytic cell line U937 showed Ca2+ transients following thrombin or agonist peptide stimulation.68 The different results obtained in the former study and our own results illustrate the difficulty of extrapolating results obtained with continuous cell lines to the situation with untransformed cells.
Monocytes undergo a plethora of phenotypic and functional changes during differentiation into macrophages or foam cells. Therefore, we studied thrombin-induced cytokine production in monocytes differentiated in vitro toward macrophages and rendered foam celllike by loading with acetylated LDL. Those maneuvers effectively induce the macrophage scavenger receptor.42 69 However, monocyte differentiation did not confer increased responsiveness to thrombin.
Our data suggest that peripheral blood monocytes trapped in or attracted to sites of thrombosis may not respond well to thrombin with cytokine production, although others have found thrombin to be a potent chemoattractant for monocytes independent of the catalytic activity of the enzyme.40 In sharp contrast to the situation with monocytes/macrophages, thrombin was a potent stimulus for cytokine production by vascular SMCs. The cytokines examined, MCP-1 and IL-6, may both mediate various inflammatory aspects of atherogenesis. Previous work by us38 and others70 has identified vascular SMCs as source of these proinflammatory cytokines, which can influence many functions of different cell types within atheroma. In accord with our present findings on MCP-1, Wenzel et al43 recently reported that thrombin elicits gene expression and biological activity of this chemokine in rat and human SMCs. Recently, Wilcox et al71 described increased expression of thrombin receptor mRNA and protein after vascular injury. Our group found increased expression of various cytokines and cytokine-inducible molecules in SMCs very early after balloon injury of nonatheromatous arteries, even before macrophage recruitment to the vessel wall.9 72 Via activation of the thrombin receptor, thrombin associated with mural thrombosis could induce cytokine expression in SMCs independent of the presence of leukocytes.
The present results suggest that thrombin may not directly stimulate monocytes/macrophages; however, thrombin-activated SMCs might in turn stimulate macrophages by elaborating cytokines or other mediators, as suggested recently by a study showing increased monocyte chemotaxis through MCP-1 secreted by thrombin-activated SMCs.43 This possibility adds another layer to the already complicated interaction of various cell types present in atheroma.64 Our observations also offer insight into the mechanisms by which anticoagulant therapy, an effective treatment for acute coronary syndromes such as unstable angina pectoris,73 could reduce inflammation within the vessel wall and thereby stabilize the plaque in addition to preventing thrombotic vessel closure. In conclusion, the present study suggests a novel molecular link between thrombosis and inflammation within the vessel wall, with potential relevance for the pathogenesis of atherosclerosis and restenosis.
| Selected Abbreviations and Acronyms |
|---|
|
| Acknowledgments |
|---|
| Footnotes |
|---|
Presented in part at the VIIIth International Symposium on the Biology of Vascular Cells, Heidelberg, Germany, August 30 to September 4, 1994, and at the 67th Scientific Sessions of the American Heart Association, Dallas, Tex, November 14-17, 1994.
Received December 6, 1995; accepted April 30, 1996.
| References |
|---|
|
|
|---|
2. Brogi E, Winkles JA, Underwood R, Clinton SK, Alberts GF, Libby P. Distinct patterns of expression of fibroblast growth factors and their receptors in human atheroma and nonatherosclerotic arteries: association of acidic FGF with plaque microvessels and macrophages. J Clin Invest. 1993;92:2408-2418.
3.
van der Wal AC, Becker AE, van der Loos CM, Das PK. Site of intimal rupture or erosion of thrombosed coronary atherosclerotic plaques is characterized by an inflammatory process irrespective of the dominant plaque morphology. Circulation. 1994;89:36-44.
4. Smith EB, Staples EM. Haemostatic factors in human aortic intima. Lancet. 1981;1:1171-1174.[Medline] [Order article via Infotrieve]
5.
Bini A, Fenoglio JJ Jr, Mesa-Tejada R, Kudryk B, Kaplan KL. Identification and distribution of fibrinogen, fibrin, and fibrin(ogen) degradation products in atherosclerosis: use of monoclonal antibodies. Arteriosclerosis. 1989;9:109-121.
6. Fuster V, Badimon L, Badimon JJ, Chesebro JH. The pathogenesis of coronary artery disease and the acute coronary syndromes. N Engl J Med. 1992;326(pt 1):242-250.
7. den Heijer P, van Dijk RB, Hillege HL, Pentinga ML, Serruys PW, Lie KI. Serial angioscopic and angiographic observations during the first hour after successful coronary angioplasty: a preamble to a multicenter trial addressing angioscopic markers for restenosis. Am Heart J. 1994;128:656-663.[Medline] [Order article via Infotrieve]
8. Hatton MWC, Moar SL, Richardson M. Deendothelialization in vivo initiates a thrombogenic reaction at the rabbit aorta surface: correlation of uptake of fibrinogen and antithrombin III with thrombin generation by the exposed subendothelium. Am J Pathol. 1989;135:499-508.[Abstract]
9.
Tanaka H, Sukhova GK, Swanson SJ, Clinton SK, Ganz P, Cybulsky MI, Libby P. Sustained activation of vascular cells and leukocytes in the rabbit aorta after balloon injury. Circulation. 1993;88:1788-1803.
10. Munro JM, Cotran RS. The pathogenesis of atherosclerosis: atherogenesis and inflammation. Lab Invest. 1988;58:249-261.[Medline] [Order article via Infotrieve]
11.
Alexander RW. Inflammation and coronary artery disease. N Engl J Med. 1994;331:468-469.
12. Libby P, Schwartz D, Brogi E, Tanaka H, Clinton SK. A cascade model for restenosis: a special case of atherosclerosis progression. Circulation. 1992;86(suppl III):III-47-III-52.
13.
Jonasson L, Holm J, Skalli O, Bondjers G, Hansson GK. Regional accumulations of T cells, macrophages, and smooth muscle cells in the human atherosclerotic plaque. Arteriosclerosis. 1986;6:131-138.
14.
Fenton JW II, Fasco MJ, Stackrow AB, Aronson DL, Young AM, Finlayson JS. Human thrombins: production, evaluation, and properties of
-thrombin. J Biol Chem. 1977;252:3587-3598.
15.
Sonder SA, Fenton JW II. Proflavin binding within the fibrinopeptide groove adjacent to the catalytic site of human
-thrombin. Biochemistry. 1984;23:1818-1823.[Medline]
[Order article via Infotrieve]
16. Vu TKH, Hung DT, Wheaton VI, Coughlin SR. Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation. Cell. 1991;64:1057-1068.[Medline] [Order article via Infotrieve]
17.
Vassallo RR Jr, Kieber-Emmons T, Cichowski K, Brass LF. Structure-function relationships in the activation of platelet thrombin receptors by receptor-derived peptides. J Biol Chem. 1992;267:6081-6085.
18. Libby P, O'Brien KV. Culture of quiescent arterial smooth muscle cells in a defined serum-free medium. J Cell Physiol. 1983;115:217-223.[Medline] [Order article via Infotrieve]
19.
Luscinskas FW, Kansas GS, Ding H, Pizcueta P, Schleiffenbaum BE, Tedder TF, Gimbrone MA Jr. Monocyte rolling, arrest and spreading on IL-4-activated vascular endothelium under flow is mediated via sequential action of L-selectin, ß1-integrins, and ß2-integrins. J Cell Biol. 1994;125:1417-1427.
20. Warner SJ, Auger KR, Libby P. Interleukin 1 induces interleukin 1, II: recombinant human interleukin 1 induces interleukin 1 production by adult human vascular endothelial cells. J Immunol. 1987;139:1911-1917.[Abstract]
21. Sambrook JFE, Maniatis T. Molecular Cloning. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press; 1989.
22. Zilberstein A, Ruggieri R, Korn JH, Revel M. Structure and expression of cDNA and genes for human interferon-beta-2, a distinct species inducible by growth-stimulatory cytokines. EMBO J. 1986;5:2529-2537.[Medline] [Order article via Infotrieve]
23.
Rollins BJ, Stier P, Ernst T, Wong GG. The human homolog of the JE gene encodes a monocyte secretory protein. Mol Cell Biol. 1989;9:4687-4695.
24. Libby P, Ordovas JM, Auger KR, Robbins AH, Birinyi LK, Dinarello CA. Endotoxin and tumor necrosis factor induce interleukin-1 gene expression in adult human vascular endothelial cells. Am J Pathol. 1986;124:179-185.[Abstract]
25.
Wang AM, Creasey AA, Ladner MB, Lin LS, Strickler J, Van Arsdell JN, Yamamoto R, Mark DF. Molecular cloning of the complementary DNA for human tumor necrosis factor. Science. 1985;228:149-154.
26.
Grynkiewicz G, Poenie M, Tsien RY. A new generation of Ca2+ indicators with greatly improved fluorescence properties. J Biol Chem. 1985;260:3440-3450.
27. Sozzani S, Molino M, Locati M, Luini W, Cerletti C, Vecchi A, Mantovani A. Receptor-activated calcium influx in human monocytes exposed to monocyte chemotactic protein-1 and related cytokines. J Immunol. 1993;150:1544-1553.[Abstract]
28. Harlow E, Lane D. Antibodies: A Laboratory Manual. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press; 1988.
29.
Ishii K, Hein L, Kobilka B, Coughlin SR. Kinetics of thrombin receptor cleavage on intact cells: relation to signaling. J Biol Chem. 1993;268:9780-9786.
30.
Lanza F, Wolf D, Fox CF, Kieffer N, Seyer JM, Fried VA, Coughlin SR, Phillips DR, Jennings LK. cDNA cloning and expression of platelet p24/CD9: evidence for a new family of multiple membrane-spanning proteins. J Biol Chem. 1991;266:10638-10645.
31.
Chen J, Ishii M, Wang L, Ishii K, Coughlin SR. Thrombin receptor activation: confirmation of the intramolecular tethered liganding hypothesis and discovery of an alternative intermolecular liganding mode. J Biol Chem. 1994;269:16041-16045.
32. Mathews II, Padmanabhan KP, Ganesh V, Tulinsky A, Ishii M, Chen J, Turck CW, Coughlin SR, Fenton JW II. Crystallographic structures of thrombin complexed with thrombin receptor peptides: existence of expected and novel binding modes. Biochemistry. 1994;33:3266-3279.[Medline] [Order article via Infotrieve]
33. Vu TKH, Wheaton VI, Hung DT, Charo I, Coughlin SR. Domains specifying thrombin-receptor interaction. Nature. 1991;353:674-677.[Medline] [Order article via Infotrieve]
34.
Liu LW, Vu TKH, Esmon CT, Coughlin SR. The region of the thrombin receptor resembling hirudin binds to thrombin and alters enzyme specificity. J Biol Chem. 1991;266:16977-16980.
35. Hung DT, Vu TKH, Wheaton VI, Ishii K, Coughlin SR. Cloned platelet thrombin receptor is necessary for thrombin-induced platelet activation. J Clin Invest. 1992;89:1350-1353.
36.
Ishii K, Chen J, Ishii M, Koch WJ, Freedman NJ, Lefkowitz RJ, Coughlin SR. Inhibition of thrombin receptor signaling by a G-protein coupled receptor kinase: functional specificity among G-protein coupled receptor kinases. J Biol Chem. 1994;269:1125-1130.
37. Barnstable CJ, Bodmer WF, Brown G, Galfre G, Milstein C, Williams AF, Ziegler A. Production of monoclonal antibodies to group A erythrocytes, HLA and other human cell surface antigensnew tools for genetic analysis. Cell. 1978;14:9-20.[Medline] [Order article via Infotrieve]
38. Loppnow H, Libby P. Proliferating or interleukin 1-activated human vascular smooth muscle cells secrete copious interleukin 6. J Clin Invest. 1990;85:731-738.
39. Warner SJC, Libby P. Human vascular smooth muscle cells: target for and source of tumor necrosis factor. J Immunol. 1989;142:100-109.[Abstract]
40.
Bar-Shavit R, Kahn A, Wilner GD, Fenton JW II. Monocyte chemotaxis: stimulation by specific exosite region in thrombin. Science. 1983;220:728-731.
41. Tushinski RJ, Oliver IT, Guilbert LJ, Tynan PW, Warner JR, Stanley ER. Survival of mononuclear phagocytes depends on a lineage-specific growth factor that the differentiated cells selectively destroy. Cell. 1982;28:71-81.[Medline] [Order article via Infotrieve]
42. Clinton SK, Underwood R, Hayes L, Sherman ML, Kufe DW, Libby P. Macrophage colony-stimulating factor gene expression in vascular cells and in experimental and human atherosclerosis. Am J Pathol. 1992;140:301-316.[Abstract]
43.
Wenzel UO, Fouqueray B, Grandaliano G, Kim Y-S, Karamitsos C, Valente AJ, Abboud HE. Thrombin regulates expression of monocyte chemoattractant protein-1 in vascular smooth muscle cells. Circ Res. 1995;77:503-509.
44.
Grandaliano G, Valente AJ, Abboud HE. A novel biologic activity of thrombin: stimulation of monocyte chemotactic protein production. J Exp Med. 1994;179:1737-1741.
45. McNamara CA, Sarembock IJ, Gimple LW, Fenton JW II, Coughlin SR, Owens GK. Thrombin stimulates proliferation of cultured rat aortic smooth muscle cells by a proteolytically activated receptor. J Clin Invest. 1993;91:94-98.
46. Berk BC, Taubman MB, Griendling KK, Cragoe EJ Jr, Fenton JW II, Brock TA. Thrombin-stimulated events in cultured vascular smooth-muscle cells. Biochem J. 1991;274:799-805.
47. Coughlin SR, Vu TKH, Hung DT, Wheaton VI. Characterization of a functional thrombin receptor: issues and opportunities. J Clin Invest. 1992;89:351-355.
48. Nelken NA, Soifer SJ, O'Keefe J, Vu TKH, Charo IF, Coughlin SR. Thrombin receptor expression in normal and atherosclerotic human arteries. J Clin Invest. 1992;90:1614-1621.
49. Joseph S, MacDermot J. Stimulation of U937 human monocytic cells by thrombin results in inositol trisphosphate formation and the mobilisation of intracellular Ca2+ but not the synthesis of thromboxane B2. Biochem Soc Trans. 1991;19:89S. Abstract.[Medline] [Order article via Infotrieve]
50.
Hung DT, Vu TH, Nelken NA, Coughlin SR. Thrombin-induced events in non-platelet cells are mediated by the unique proteolytic mechanism established for the cloned platelet thrombin receptor. J Cell Biol. 1992;116:827-832.
51.
Hung DT, Wong YH, Vu TKH, Coughlin SR. The cloned platelet thrombin receptor couples to at least two distinct effectors to stimulate phosphoinositide hydrolysis and inhibit adenylyl cyclase. J Biol Chem. 1992;267:20831-20834.
52.
Brass LF, Laposata M, Banga HS, Rittenhouse SE. Regulation of the phosphoinositide hydrolysis pathway in thrombin-stimulated platelets by a pertussis toxin-sensitive guanine nucleotide-binding protein: evaluation of its contribution to platelet activation and comparisons with the adenylate cyclase inhibitory protein, Gi. J Biol Chem. 1986;261:16838-16847.
53. Paris S, Pouyssegur J. Pertussis toxin inhibits thrombin-induced activation of phosphoinositide hydrolysis and Na+/H+ exchange in hamster fibroblasts. EMBO J. 1986;5:55-60.[Medline] [Order article via Infotrieve]
54. Sozzani S, Luini W, Molino M, Jilek P, Bottazzi B, Cerletti C, Matsushima K, Mantovani A. The signal transduction pathway involved in the migration induced by a monocyte chemotactic cytokine. J Immunol. 1991;147:2215-2221.[Abstract]
55.
Myers SJ, Wong LM, Charo IF. Signal transduction and ligand specificity of the human monocyte. J Biol Chem. 1995;270:5786-5792.
56. Shuman MA. Thrombin-cellular interactions. Ann N Y Acad Sci. 1986;485:228-239.[Medline] [Order article via Infotrieve]
57. Kanthou C, Parry G, Wijelath E, Kakkar VV, Demoliou-Mason C. Thrombin-induced proliferation and expression of platelet-derived growth factor-A chain gene in human vascular smooth muscle cells. FEBS Lett. 1992;314:143-148.[Medline] [Order article via Infotrieve]
58. Herbert JM, Lamarche I, Dol F. Induction of vascular smooth muscle cell growth by selective activation of the thrombin receptor: effect of heparin. FEBS Lett. 1992;301:155-158.[Medline] [Order article via Infotrieve]
59.
Gordon D, Reidy MA, Benditt EP, Schwartz SM. Cell proliferation in human coronary arteries. Proc Natl Acad Sci U S A. 1990;87:4600-4604.
60.
O'Brien ER, Alpers CE, Stewart DK, Ferguson M, Tran N, Gordon D, Benditt EP, Hinohara T, Simpson JB, Schwartz SM. Proliferation in primary and restenotic coronary atherectomy tissue: implications for antiproliferative therapy. Circ Res. 1993;73:223-231.
61. Pickering JG, Weir L, Jekanowski J, Kearney MA, Isner JM. Proliferative activity in peripheral and coronary atherosclerotic plaque among patients undergoing percutaneous revascularization. J Clin Invest. 1993;91:1469-1480.
62. Libby P, Clinton SK. The role of macrophages in atherogenesis. Curr Opin Lipidol. 1993;4:355-363.
63. Nathan CF. Secretory products of macrophages. J Clin Invest. 1987;79:319-326.
64. Ross R. The pathogenesis of atherosclerosis: a perspective for the 1990s. Nature. 1993;362:801-809.[Medline] [Order article via Infotrieve]
65. Jones A, Geczy CL. Thrombin and factor Xa enhance the production of interleukin-1. Immunology. 1990;71:236-241.[Medline] [Order article via Infotrieve]
66. Colotta F, Sciacca FL, Sironi M, Luini W, Rabiet MJ, Mantovani A. Expression of monocyte chemotactic protein-1 by monocytes and endothelial cells exposed to thrombin. Am J Pathol. 1994;144:975-985.[Abstract]
67. Hoffman M, Church FC. Response of blood leukocytes to thrombin receptor peptides. J Leukoc Biol. 1993;54:145-151.[Abstract]
68. Joseph S, MacDermot J. The N-terminal thrombin receptor fragment SFLLRN, but not catalytically inactive thrombin-derived agonists, activate U937 human monocytic cells: evidence for receptor hydrolysis in thrombin-dependent signalling. Biochem J. 1993;290:571-577.
69.
Geng Y, Kodama T, Hansson GK. Differential expression of scavenger receptor isoforms during monocyte-macrophage differentiation and foam cell formation. Arterioscler Thromb. 1994;14:798-806.
70.
Wang JM, Sica A, Peri G, Walter S, Padura IM, Libby P, Ceska M, Lindley I, Colotta F, Mantovani A. Expression of monocyte chemotactic protein and interleukin-8 by cytokine-activated human vascular smooth muscle cells. Arterioscler Thromb. 1991;11:1166-1174.
71.
Wilcox JN, Rodriguez J, Subramanian R, Ollerenshaw J, Zhong C, Hayzer DJ, Horaist C, Hanson SR, Lumsden A, Salam TA, Kelly AB, Harker LA, Runge M. Characterization of thrombin receptor expression during vascular lesion formation. Circ Res. 1994;75:1029-1038.
72.
Tanaka H, Sukhova G, Schwartz D, Libby P. Proliferating arterial smooth muscle cells after balloon injury express TNF-
but not interleukin-1 or basic fibroblast growth factor. Arterioscler Thromb Vasc Biol. 1996;16:12-18.
73. Theroux P, Ouimet H, McCans J, Latour JG, Joly P, Levy G, Pelletier E, Juneau M, Stasiak J, deGuise P, Pelletier GB, Rinzler D, Waters DD. Aspirin, heparin, or both to treat acute unstable angina. N Engl J Med. 1988;319:1105-1111.[Abstract]
This article has been cited by other articles:
![]() |
J. I. Borissoff, H. M.H. Spronk, S. Heeneman, and H. ten Cate Is thrombin a key player in the 'coagulation-atherogenesis' maze? Cardiovasc Res, June 1, 2009; 82(3): 392 - 403. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. M. Osipov, C. Bianchi, R. T. Clements, J. Feng, Y. Liu, S.-H. Xu, M. P. Robich, J. Wagstaff, and F. W. Sellke Thrombin Fragment (TP508) Decreases Myocardial Infarction and Apoptosis After Ischemia Reperfusion Injury. Ann. Thorac. Surg., March 1, 2009; 87(3): 786 - 793. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Loppnow, K. Werdan, and M. Buerke Invited review: Vascular cells contribute to atherosclerosis by cytokine- and innate-immunity-related inflammatory mechanisms Innate Immunity, April 1, 2008; 14(2): 63 - 87. [Abstract] [PDF] |
||||
![]() |
M. O'Brien, J. J Morrison, and T. J Smith Expression of Prothrombin and Protease Activated Receptors in Human Myometrium During Pregnancy and Labor Biol Reprod, January 1, 2008; 78(1): 20 - 26. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. R.S. Day, K. M. Taylor, E. A. Lidington, J. C. Mason, D. O. Haskard, A. M. Randi, and R. C. Landis Aprotinin inhibits proinflammatory activation of endothelial cells by thrombin through the protease-activated receptor 1 J. Thorac. Cardiovasc. Surg., January 1, 2006; 131(1): 21 - 27. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Steinhoff, J. Buddenkotte, V. Shpacovitch, A. Rattenholl, C. Moormann, N. Vergnolle, T. A. Luger, and M. D. Hollenberg Proteinase-Activated Receptors: Transducers of Proteinase-Mediated Signaling in Inflammation and Immune Response Endocr. Rev., February 1, 2005; 26(1): 1 - 43. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-F. Legare and D. B. Ross Suggestion for functional model to test effects of decellularization of rat aortic valve allografts on leaflet destruction and extracellular matrix remodeling. J. Thorac. Cardiovasc. Surg., July 1, 2004; 128(1): 155 - 156. [Full Text] [PDF] |
||||
![]() |
R. Colognato, J. R. Slupsky, M. Jendrach, L. Burysek, T. Syrovets, and T. Simmet Differential expression and regulation of protease-activated receptors in human peripheral monocytes and monocyte-derived antigen-presenting cells Blood, October 1, 2003; 102(7): 2645 - 2652. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. de Jonge, P. W. Friederich, G. P. Vlasuk, W. E. Rote, M. B. Vroom, M. Levi, and T. van der Poll Activation of Coagulation by Administration of Recombinant Factor VIIa Elicits Interleukin 6 (IL-6) and IL-8 Release in Healthy Human Subjects Clin. Vaccine Immunol., May 1, 2003; 10(3): 495 - 497. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. L. Copple, F. Moulin, U. M. Hanumegowda, P. E. Ganey, and R. A. Roth Thrombin and Protease-Activated Receptor-1 Agonists Promote Lipopolysaccharide-Induced Hepatocellular Injury in Perfused Livers J. Pharmacol. Exp. Ther., May 1, 2003; 305(2): 417 - 425. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. A. Boven, N. Vergnolle, S. D. Henry, C. Silva, Y. Imai, J. Holden, K. Warren, M. D. Hollenberg, and C. Power Up-Regulation of Proteinase-Activated Receptor 1 Expression in Astrocytes During HIV Encephalitis J. Immunol., March 1, 2003; 170(5): 2638 - 2646. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Minami, Md. R. Abid, J. Zhang, G. King, T. Kodama, and W. C. Aird Thrombin Stimulation of Vascular Adhesion Molecule-1 in Endothelial Cells Is Mediated by Protein Kinase C (PKC)-delta -NF-kappa B and PKC-zeta -GATA Signaling Pathways J. Biol. Chem., February 21, 2003; 278(9): 6976 - 6984. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. J. Chong, T. H. Pohlman, C. R. Hampton, A. Shimamoto, N. Mackman, and E. D. Verrier Tissue factor and thrombin mediate myocardial ischemia-reperfusion injury Ann. Thorac. Surg., February 1, 2003; 75(2): S649 - 655. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Tokunou, T. Ichiki, K. Takeda, Y. Funakoshi, N. Iino, H. Shimokawa, K. Egashira, and A. Takeshita Thrombin Induces Interleukin-6 Expression Through the cAMP Response Element in Vascular Smooth Muscle Cells Arterioscler Thromb Vasc Biol, November 1, 2001; 21(11): 1759 - 1763. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Syrovets, M. Jendrach, A. Rohwedder, A. Schule, and T. Simmet Plasmin-induced expression of cytokines and tissue factor in human monocytes involves AP-1 and IKK{beta}-mediated NF-{kappa}B activation Blood, June 15, 2001; 97(12): 3941 - 3950. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Patterson, G. A. Stouffer, N. Madamanchi, and M. S. Runge New Tricks for Old Dogs : Nonthrombotic Effects of Thrombin in Vessel Wall Biology Circ. Res., May 25, 2001; 88(10): 987 - 997. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Libby and D. I. Simon Inflammation and Thrombosis : The Clot Thickens Circulation, April 3, 2001; 103(13): 1718 - 1720. [Full Text] [PDF] |
||||
![]() |
J. H. Erlich, E. M. Boyle, J. Labriola, J. C. Kovacich, R. A. Santucci, C. Fearns, E. N. Morgan, W. Yun, T. Luther, O. Kojikawa, et al. Inhibition of the Tissue Factor-Thrombin Pathway Limits Infarct Size after Myocardial Ischemia-Reperfusion Injury by Reducing Inflammation Am. J. Pathol., December 1, 2000; 157(6): 1849 - 1862. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. L. Abbott, J. R. Loss II, A. M. Robida, and T. J. Murphy Evidence That Galpha q-Coupled Receptor-Induced Interleukin-6 mRNA in Vascular Smooth Muscle Cells Involves the Nuclear Factor of Activated T Cells Mol. Pharmacol., November 1, 2000; 58(5): 946 - 953. [Abstract] [Full Text] |
||||
![]() |
R. C. Woodman, D. Teoh, D. Payne, and P. Kubes Thrombin and leukocyte recruitment in endotoxemia Am J Physiol Heart Circ Physiol, September 1, 2000; 279(3): H1338 - H1345. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y Hojo, U Ikeda, T Katsuki, O Mizuno, H Fukazawa, K Kurosaki, H Fujikawa, and K Shimada Interleukin 6 expression in coronary circulation after coronary angioplasty as a risk factor for restenosis Heart, July 1, 2000; 84(1): 83 - 87. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. A. Stoop, F. Lupu, and H. Pannekoek Colocalization of Thrombin, PAI-1, and Vitronectin in the Atherosclerotic Vessel Wall : A Potential Regulatory Mechanism of Thrombin Activity by PAI-1/Vitronectin Complexes Arterioscler Thromb Vasc Biol, April 1, 2000; 20(4): 1143 - 1149. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Kranzhofer, J. Schmidt, C. A. H. Pfeiffer, S. Hagl, P. Libby, and W. Kubler Angiotensin Induces Inflammatory Activation of Human Vascular Smooth Muscle Cells Arterioscler Thromb Vasc Biol, July 1, 1999; 19(7): 1623 - 1629. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. P. Fabunmi, G. K. Sukhova, S. Sugiyama, and P. Libby Expression of Tissue Inhibitor of Metalloproteinases-3 in Human Atheroma and Regulation in Lesion-Associated Cells : A Potential Protective Mechanism in Plaque Stability Circ. Res., August 10, 1998; 83(3): 270 - 278. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Johnson, Y. Choi, E. DeGroot, I. Samuels, A. Creasey, and L. Aarden Potential Mechanisms for a Proinflammatory Vascular Cytokine Response to Coagulation Activation J. Immunol., May 15, 1998; 160(10): 5130 - 5135. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Loppnow, R. Bil, S. Hirt, U. Schonbeck, M. Herzberg, K. Werdan, E. Theodor Rietschel, E. Brandt, and H.-D. Flad Platelet-Derived Interleukin-1 Induces Cytokine Production, but not Proliferation of Human Vascular Smooth Muscle Cells Blood, January 1, 1998; 91(1): 134 - 141. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. B. Schini-Kerth, S. Bassus, B. Fisslthaler, C. M. Kirchmaier, and R. Busse Aggregating Human Platelets Stimulate the Expression of Thrombin Receptors in Cultured Vascular Smooth Muscle Cells via the Release of Transforming Growth Factor-ß1 and Platelet-Derived Growth FactorAB Circulation, December 2, 1997; 96(11): 3888 - 3896. [Abstract] [Full Text] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Circulation Research Home | Subscriptions | Archives | Feedback | Authors | Help | AHA Journals Home | Search Copyright © 1996 American Heart Association, Inc. All rights reserved. Unauthorized use prohibited. |